SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g38251

Feature Type:gene_model
Chromosome:Gm04
Start:44654923
stop:44655414
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g38251
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G02130AT Annotation by Michelle Graham. TAIR10: low-molecular-weight cysteine-rich 68 | chr2:540071-540407 FORWARD LENGTH=77 SoyBaseE_val: 1.00E-17ISS
GO:0000271GO-bp Annotation by Michelle Graham. GO Biological Process: polysaccharide biosynthetic process SoyBaseN/AISS
GO:0006952GO-bp Annotation by Michelle Graham. GO Biological Process: defense response SoyBaseN/AISS
GO:0007389GO-bp Annotation by Michelle Graham. GO Biological Process: pattern specification process SoyBaseN/AISS
GO:0008361GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell size SoyBaseN/AISS
GO:0009825GO-bp Annotation by Michelle Graham. GO Biological Process: multidimensional cell growth SoyBaseN/AISS
GO:0009926GO-bp Annotation by Michelle Graham. GO Biological Process: auxin polar transport SoyBaseN/AISS
GO:0009932GO-bp Annotation by Michelle Graham. GO Biological Process: cell tip growth SoyBaseN/AISS
GO:0010015GO-bp Annotation by Michelle Graham. GO Biological Process: root morphogenesis SoyBaseN/AISS
GO:0010075GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth SoyBaseN/AISS
GO:0010817GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hormone levels SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0040007GO-bp Annotation by Michelle Graham. GO Biological Process: growth SoyBaseN/AISS
GO:0043481GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0071555GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall organization SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0030414GO-mf Annotation by Michelle Graham. GO Molecular Function: peptidase inhibitor activity SoyBaseN/AISS
PF00304PFAM Gamma-thionin family JGI ISS
UniRef100_B9RHP2UniRef Annotation by Michelle Graham. Most informative UniRef hit: 8.4 kDa sulfur-rich protein, putative n=1 Tax=Ricinus communis RepID=B9RHP2_RICCO SoyBaseE_val: 5.00E-15ISS
UniRef100_UPI0002339674UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002339674 related cluster n=1 Tax=unknown RepID=UPI0002339674 SoyBaseE_val: 8.00E-32ISS

Expression Patterns of Glyma04g38251
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g38251 not represented in the dataset
Glyma04g38251 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g38251
ParalogEvidenceComments
Glyma06g16810 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g38251 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g205200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g38251
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g38251
>Glyma04g38251.1   sequence type=CDS   gene model=Glyma04g38251   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACAAGGCACGATTTGGGCTTTTCTTCATGTTGCTCATTCTCCTTGCTTCTCGTAAGCCTCTATCCATGCATTTACGAAGCCATCGATTTAAAGGGATGTGCCTCAGTGAGCACAACTGCGCTTCGGTTAGCCATCTTGAAGGCTTCACAGGTGGCAAGTGTTGGGGATTTCGCAGACGCTGTTTCTGCTCCAAGCACTGTTAG
Predicted protein sequences of Glyma04g38251
>Glyma04g38251.1   sequence type=predicted peptide   gene model=Glyma04g38251   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDKARFGLFFMLLILLASRKPLSMHLRSHRFKGMCLSEHNCASVSHLEGFTGGKCWGFRRRCFCSKHC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo